Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148603.1 | internal | 222 | 2-667(+) |
Amino Acid sequence : | |||
HETDRSFGLRNFRYLDTIKEAVERECPEVVSCSDILVLSGREGIAALGGPYIPLKTGRRDGRRSRADILEQYLPDHNESISVVLERFGAMGIDTPGVVALLGSHSVGRTHCVKLVHRLYP EVDPQLNPDHLPHMFKKCPDAIPDPKSVQYVRNDRGTPMILDNNYYNNILDNKGLLLVDHQLAYDKKTRPYVKKMAKSQDYFFKEFSRAITILSENNPLTGT | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 25,150.392 | ||
Theoretical pI: | 7.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 15150 | ||
Instability index: | 35.564 | ||
aromaticity | 0.077 | ||
GRAVY | -0.482 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.243 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148603.1 | internal | 222 | 2-667(+) |
Amino Acid sequence : | |||
HETDRSFGLRNFRYLDTIKEAVERECPEVVSCSDILVLSGREGIAALGGPYIPLKTGRRDGRRSRADILEQYLPDHNESISVVLERFGAMGIDTPGVVALLGSHSVGRTHCVKLVHRLYP EVDPQLNPDHLPHMFKKCPDAIPDPKSVQYVRNDRGTPMILDNNYYNNILDNKGLLLVDHQLAYDKKTRPYVKKMAKSQDYFFKEFSRAITILSENNPLTGT | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 25,150.392 | ||
Theoretical pI: | 7.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 15150 | ||
Instability index: | 35.564 | ||
aromaticity | 0.077 | ||
GRAVY | -0.482 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.243 | ||
sheet | 0.221 |