| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148608.1 | internal | 178 | 2-535(+) |
Amino Acid sequence : | |||
| KQVKSGDRSRSYYKCTNSSCPAKKKIERCPDGRETEIIYMGNHNHEPHHKTPCSKERKRPSVPSAENECLDIVMAEVNESDPSTSKADQNSGNETPDQRLYCSSDCEGDTAVKAEEEPID HEPYPKRRLSECLTPLSAPVLKTIKEPKIVVQSASEAGRINDGYRWRKYGQKIVKGNP | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 20,019.151 | ||
| Theoretical pI: | 8.112 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16430 | ||
| Instability index: | 64.127 | ||
| aromaticity | 0.045 | ||
| GRAVY | -1.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.180 | ||
| turn | 0.287 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148608.1 | internal | 178 | 2-535(+) |
Amino Acid sequence : | |||
| KQVKSGDRSRSYYKCTNSSCPAKKKIERCPDGRETEIIYMGNHNHEPHHKTPCSKERKRPSVPSAENECLDIVMAEVNESDPSTSKADQNSGNETPDQRLYCSSDCEGDTAVKAEEEPID HEPYPKRRLSECLTPLSAPVLKTIKEPKIVVQSASEAGRINDGYRWRKYGQKIVKGNP | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 20,019.151 | ||
| Theoretical pI: | 8.112 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16430 | ||
| Instability index: | 64.127 | ||
| aromaticity | 0.045 | ||
| GRAVY | -1.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.180 | ||
| turn | 0.287 | ||
| sheet | 0.197 | ||