Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148608.1 | internal | 178 | 2-535(+) |
Amino Acid sequence : | |||
KQVKSGDRSRSYYKCTNSSCPAKKKIERCPDGRETEIIYMGNHNHEPHHKTPCSKERKRPSVPSAENECLDIVMAEVNESDPSTSKADQNSGNETPDQRLYCSSDCEGDTAVKAEEEPID HEPYPKRRLSECLTPLSAPVLKTIKEPKIVVQSASEAGRINDGYRWRKYGQKIVKGNP | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 20,019.151 | ||
Theoretical pI: | 8.112 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16430 | ||
Instability index: | 64.127 | ||
aromaticity | 0.045 | ||
GRAVY | -1.144 | ||
Secondary Structure Fraction | |||
Helix | 0.180 | ||
turn | 0.287 | ||
sheet | 0.197 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148608.1 | internal | 178 | 2-535(+) |
Amino Acid sequence : | |||
KQVKSGDRSRSYYKCTNSSCPAKKKIERCPDGRETEIIYMGNHNHEPHHKTPCSKERKRPSVPSAENECLDIVMAEVNESDPSTSKADQNSGNETPDQRLYCSSDCEGDTAVKAEEEPID HEPYPKRRLSECLTPLSAPVLKTIKEPKIVVQSASEAGRINDGYRWRKYGQKIVKGNP | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 20,019.151 | ||
Theoretical pI: | 8.112 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16430 | ||
Instability index: | 64.127 | ||
aromaticity | 0.045 | ||
GRAVY | -1.144 | ||
Secondary Structure Fraction | |||
Helix | 0.180 | ||
turn | 0.287 | ||
sheet | 0.197 |