| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148611.1 | internal | 115 | 1-345(+) |
Amino Acid sequence : | |||
| EVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMN | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,560.677 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 31.309 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.217 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148611.1 | internal | 115 | 345-1(-) |
Amino Acid sequence : | |||
| IHTGTYTTPSAKRYEFEIMTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQRSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHF | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,560.677 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 31.309 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.217 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148611.1 | internal | 115 | 1-345(+) |
Amino Acid sequence : | |||
| EVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMN | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,560.677 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 31.309 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.217 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148611.1 | internal | 115 | 345-1(-) |
Amino Acid sequence : | |||
| IHTGTYTTPSAKRYEFEIMTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQRSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHF | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,560.677 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 31.309 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.217 | ||
| sheet | 0.183 | ||