Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148611.1 | internal | 115 | 1-345(+) |
Amino Acid sequence : | |||
EVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMN | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,560.677 | ||
Theoretical pI: | 9.511 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 31.309 | ||
aromaticity | 0.113 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.217 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148611.1 | internal | 115 | 345-1(-) |
Amino Acid sequence : | |||
IHTGTYTTPSAKRYEFEIMTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQRSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHF | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,560.677 | ||
Theoretical pI: | 9.511 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 31.309 | ||
aromaticity | 0.113 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.217 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148611.1 | internal | 115 | 1-345(+) |
Amino Acid sequence : | |||
EVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMN | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,560.677 | ||
Theoretical pI: | 9.511 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 31.309 | ||
aromaticity | 0.113 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.217 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148611.1 | internal | 115 | 345-1(-) |
Amino Acid sequence : | |||
IHTGTYTTPSAKRYEFEIMTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQRSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHF | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,560.677 | ||
Theoretical pI: | 9.511 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 31.309 | ||
aromaticity | 0.113 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.217 | ||
sheet | 0.183 |