| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148614.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
| PPGCRNSARAAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGV VGLTKCAAFELGTHGIRVNCVSPQLLSTPLT | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 15,868.130 | ||
| Theoretical pI: | 8.656 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 24.036 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.278 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148614.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
| PPGCRNSARAAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGV VGLTKCAAFELGTHGIRVNCVSPQLLSTPLT | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 15,868.130 | ||
| Theoretical pI: | 8.656 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 24.036 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.278 | ||
| sheet | 0.219 | ||