Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148626.1 | 5prime_partial | 161 | 3-488(+) |
Amino Acid sequence : | |||
KKEEEEEEEEEEEMPRSSFSGAISSPKVGLYIDMGHPFLNRTVDGFLKIGTVAATAVAAEETYHAVSKGSMSKSKAEHALKKMCTEGAYWGTVAGVYVGMEYGIERVRGTRDWKNAMVAG VLTGAVVSAASKKHGDQIAVDAIKGGAIAVAAEFLNYNFSF* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 17,259.294 | ||
Theoretical pI: | 5.435 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 39.361 | ||
aromaticity | 0.087 | ||
GRAVY | -0.204 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.224 | ||
sheet | 0.323 |