Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148627.1 | 3prime_partial | 142 | 35-460(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRG | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,058.172 | ||
Theoretical pI: | 6.407 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 25.180 | ||
aromaticity | 0.049 | ||
GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.232 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148627.1 | 3prime_partial | 142 | 35-460(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRG | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,058.172 | ||
Theoretical pI: | 6.407 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 25.180 | ||
aromaticity | 0.049 | ||
GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.232 | ||
sheet | 0.246 |