| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148632.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
| HEKDFVKRLLNKDYRKRMTASQALSHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIMIEELASELGLGPSVPVH | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 21,359.552 | ||
| Theoretical pI: | 8.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 31.613 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.183 | ||
| sheet | 0.296 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148632.1 | internal | 186 | 2-559(+) |
Amino Acid sequence : | |||
| HEKDFVKRLLNKDYRKRMTASQALSHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIMIEELASELGLGPSVPVH | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 21,359.552 | ||
| Theoretical pI: | 8.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 31.613 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.183 | ||
| sheet | 0.296 | ||