| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148640.1 | internal | 141 | 1-423(+) |
Amino Acid sequence : | |||
| VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,308.522 | ||
| Theoretical pI: | 8.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.133 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.270 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148640.1 | internal | 141 | 1-423(+) |
Amino Acid sequence : | |||
| VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,308.522 | ||
| Theoretical pI: | 8.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.133 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.270 | ||
| sheet | 0.220 | ||