Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148640.1 | internal | 141 | 1-423(+) |
Amino Acid sequence : | |||
VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,308.522 | ||
Theoretical pI: | 8.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 38.133 | ||
aromaticity | 0.071 | ||
GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.270 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148640.1 | internal | 141 | 1-423(+) |
Amino Acid sequence : | |||
VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,308.522 | ||
Theoretical pI: | 8.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 38.133 | ||
aromaticity | 0.071 | ||
GRAVY | 0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.270 | ||
sheet | 0.220 |