| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148651.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| SYKDAEEHAYRLSVFRSNMWRAKRHQKLDPSAVHGVTQFSDLTPSEFKRTFLGLRGKKGFKKMVSSAKDAPVLPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWSFSTSGALEGANFLSTG NLETLSEQQMVDCDHECDPDEADACDAGCNGGLMTTAFEYLLKSGGLEREKDYPYAGTDRGTCKFDKSKIAAS | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,198.312 | ||
| Theoretical pI: | 5.553 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 33.494 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.654 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.249 | ||
| sheet | 0.249 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148651.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| SYKDAEEHAYRLSVFRSNMWRAKRHQKLDPSAVHGVTQFSDLTPSEFKRTFLGLRGKKGFKKMVSSAKDAPVLPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWSFSTSGALEGANFLSTG NLETLSEQQMVDCDHECDPDEADACDAGCNGGLMTTAFEYLLKSGGLEREKDYPYAGTDRGTCKFDKSKIAAS | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,198.312 | ||
| Theoretical pI: | 5.553 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 33.494 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.654 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.249 | ||
| sheet | 0.249 | ||