| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148661.1 | internal | 174 | 3-524(+) |
Amino Acid sequence : | |||
| IIPFLCLERMTVIVEQRENELRGDERDISIDPKELVLDGGFVVPDSNAFGQTFRDYEAESERKKSVEEFYRVNHIHQSVDFVKKMREEYGKLNRVEMSIWECCELLNEFVDESDPDLDEP QIEHLLQTAEAIRRDYPNEDWLHLVGLIHDLGKVLLHHKFGELPQWAVVGDTFP | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 20,424.746 | ||
| Theoretical pI: | 4.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 45.809 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.172 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148661.1 | internal | 174 | 3-524(+) |
Amino Acid sequence : | |||
| IIPFLCLERMTVIVEQRENELRGDERDISIDPKELVLDGGFVVPDSNAFGQTFRDYEAESERKKSVEEFYRVNHIHQSVDFVKKMREEYGKLNRVEMSIWECCELLNEFVDESDPDLDEP QIEHLLQTAEAIRRDYPNEDWLHLVGLIHDLGKVLLHHKFGELPQWAVVGDTFP | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 20,424.746 | ||
| Theoretical pI: | 4.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 45.809 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.172 | ||
| sheet | 0.282 | ||