Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148664.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
WELSAMGTLPTYMQICYKTLYNITNEIAEATKEECNWHPIDYLKESWARLCDAFLNEAKWFQSKKMPKSDEYLKNAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATILR LWDDLGSAEDENQEGYDGSYVEYLMKENPRYSKESARDDVMKMISTSWEALNKECFS | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 20,390.880 | ||
Theoretical pI: | 4.678 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48150 | ||
Instability index: | 47.612 | ||
aromaticity | 0.119 | ||
GRAVY | -0.405 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.220 | ||
sheet | 0.316 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148664.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
WELSAMGTLPTYMQICYKTLYNITNEIAEATKEECNWHPIDYLKESWARLCDAFLNEAKWFQSKKMPKSDEYLKNAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATILR LWDDLGSAEDENQEGYDGSYVEYLMKENPRYSKESARDDVMKMISTSWEALNKECFS | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 20,390.880 | ||
Theoretical pI: | 4.678 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48150 | ||
Instability index: | 47.612 | ||
aromaticity | 0.119 | ||
GRAVY | -0.405 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.220 | ||
sheet | 0.316 |