| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148670.1 | internal | 175 | 525-1(-) |
Amino Acid sequence : | |||
| QDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQS MRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILI | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,337.530 | ||
| Theoretical pI: | 6.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.033 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.660 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.244 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148670.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
| IKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFR MPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,337.530 | ||
| Theoretical pI: | 6.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.033 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.660 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.244 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148670.1 | internal | 175 | 525-1(-) |
Amino Acid sequence : | |||
| QDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQS MRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILI | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,337.530 | ||
| Theoretical pI: | 6.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.033 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.660 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.244 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148670.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
| IKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFR MPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,337.530 | ||
| Theoretical pI: | 6.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.033 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.660 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.244 | ||
| sheet | 0.231 | ||