Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148684.1	complete	173	44-565(+)
Amino Acid sequence :
MTETIGSFLMEEKMYIQSQIILRIMVSLAALAATLVMVLNKQTVDFAGYPLEASYKLSPAFKFYVGAHAAVIAYLVLSLPFISNLVKGCILHLLDMIIMLLMVAAVAAGTTIGYVAKRGN NDVGWVEVCSYFGKFCTKTVVSLIFAYVGLILFLLMCVLSSPYKSKSRQHGNV*
Physicochemical properties
Number of amino acids:		173
Molecular weight:		18,948.592
Theoretical pI:		9.046
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18910 19160
Instability index:		34.971
aromaticity		0.110
GRAVY		0.853
Secondary Structure Fraction
Helix		0.428
turn		0.191
sheet		0.312