| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148690.1 | internal | 128 | 1-384(+) |
Amino Acid sequence : | |||
| SPTSKMAGEKVYHFDEVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPLQPTNNADKSSDFVIKILQFLV PILILGLA | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,027.719 | ||
| Theoretical pI: | 4.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 32.625 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.250 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148690.1 | internal | 128 | 1-384(+) |
Amino Acid sequence : | |||
| SPTSKMAGEKVYHFDEVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPLQPTNNADKSSDFVIKILQFLV PILILGLA | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,027.719 | ||
| Theoretical pI: | 4.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 32.625 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.250 | ||
| sheet | 0.219 | ||