Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148690.1 | internal | 128 | 1-384(+) |
Amino Acid sequence : | |||
SPTSKMAGEKVYHFDEVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPLQPTNNADKSSDFVIKILQFLV PILILGLA | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,027.719 | ||
Theoretical pI: | 4.991 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 32.625 | ||
aromaticity | 0.086 | ||
GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.250 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148690.1 | internal | 128 | 1-384(+) |
Amino Acid sequence : | |||
SPTSKMAGEKVYHFDEVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPLQPTNNADKSSDFVIKILQFLV PILILGLA | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,027.719 | ||
Theoretical pI: | 4.991 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 32.625 | ||
aromaticity | 0.086 | ||
GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.250 | ||
sheet | 0.219 |