Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414534.1	5prime_partial	134	1-405(+)
Amino Acid sequence :
IMASSKFCGIILVIAILFHSRFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEADLCLCTAIKANVLGLNLNVPVTLSLLI SACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		13,758.278
Theoretical pI:		8.532
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 625
Instability index:		55.508
aromaticity		0.030
GRAVY		0.566
Secondary Structure Fraction
Helix		0.306
turn		0.321
sheet		0.254