Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414578.1 | complete | 130 | 97-489(+) |
Amino Acid sequence : | |||
MATSVTTTLPQFNGLRSSTFSSLPTTKMATIHPIKRKGNGALGARCDFIGSSTNLIMVTSTSLMLYAGRLGLAPSANRKATAGSRLEIRDSGLQTGDPAGXTLADTLACGSVGHIIGVGV VLGLKNIGAL* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,117.047 | ||
Theoretical pI: | 10.290 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 42.426 | ||
aromaticity | 0.031 | ||
GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.310 | ||
sheet | 0.264 |