Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414599.1 | 5prime_partial | 163 | 3-494(+) |
Amino Acid sequence : | |||
NLPPAPANFIKPKKRPLSSMTPLIVTKDNQLAGVIGGSGGMNIIPAVVQVFLNHFILGMKPSVAVQNPRIYHKLIPNKVMYENWTVIDGDHIELSEERKVYLQQRGHELEAAAEGAIVQL VVQTLTSPINLGQKNRKVSNAPILHGILTAVSDPRKDGKPAVI* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,761.555 | ||
Theoretical pI: | 9.696 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 37.383 | ||
aromaticity | 0.043 | ||
GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.276 | ||
sheet | 0.233 |