Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414605.1	complete	107	53-376(+)
Amino Acid sequence :
MSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYHKPPHYKPPHYKPXHYKPPTAN*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		12,344.805
Theoretical pI:		8.603
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19370 19370
Instability index:		86.985
aromaticity		0.132
GRAVY		-1.144
Secondary Structure Fraction
Helix		0.264
turn		0.245
sheet		0.198