Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414608.1	5prime_partial	115	3-350(+)
Amino Acid sequence :
LGDVMGILNKRAVEASEKERPVPDIRTGDIVEIKLEVPENKRRLSVYKGIVMSRQYAGIHTTIRIRRIIAGIGVEIVFPLYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK*
Physicochemical properties
Number of amino acids:		115
Molecular weight:		13,350.718
Theoretical pI:		10.551
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7450
Instability index:		57.282
aromaticity		0.061
GRAVY		-0.289
Secondary Structure Fraction
Helix		0.365
turn		0.183
sheet		0.217