Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414608.1 | 5prime_partial | 115 | 3-350(+) |
Amino Acid sequence : | |||
LGDVMGILNKRAVEASEKERPVPDIRTGDIVEIKLEVPENKRRLSVYKGIVMSRQYAGIHTTIRIRRIIAGIGVEIVFPLYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,350.718 | ||
Theoretical pI: | 10.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 57.282 | ||
aromaticity | 0.061 | ||
GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.183 | ||
sheet | 0.217 |