Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414612.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
TMQQAIPYKSWQSHLSLPSLNHNHPTVGKGKGKMKMINDMVTENPVTVIVRKGCCMGHVVKHLLLGHGVNPNVYEVDEKDEDGLIKELELINGGDEKTLISNLQFSAVLIGGRLFGGLDR VMAAHITGDLVPLLKQA | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 14,212.311 | ||
Theoretical pI: | 10.144 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 53.816 | ||
aromaticity | 0.154 | ||
GRAVY | -0.250 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.179 | ||
sheet | 0.128 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414612.1 | 5prime_partial | 117 | 411-58(-) |
Amino Acid sequence : | |||
SLFQKRNQITRYMSSHNSVQPTKQSTPNQHSRKLQITYQGFLITTVDQFKLFDKTIFILFINLINVRINSMTQKQMLHYMPHTTSFSHYYRNWVLCYHVIDHLHFAFSFTHRWMVVI* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 14,212.311 | ||
Theoretical pI: | 10.144 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 53.816 | ||
aromaticity | 0.154 | ||
GRAVY | -0.250 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.179 | ||
sheet | 0.128 |