Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414632.1	internal	169	3-509(+)
Amino Acid sequence :
GKTDDFETSLQVLRGFDTDISVEVNEIKRAVSSGSRSATIRFSDLKRRKYWFPLMVGIGLLVLQQLSGINGVLFYSSNIFKNAGISSSNVATFGLGLIQVIATAVTTWLADKSGRRLLLI VSSSGMTISLLIVAVAFYVEGIVSKDSHLYSVMGIFSLVGLVAMVIFFS
Physicochemical properties
Number of amino acids:		169
Molecular weight:		18,296.134
Theoretical pI:		9.570
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		35.140
aromaticity		0.101
GRAVY		0.615
Secondary Structure Fraction
Helix		0.420
turn		0.260
sheet		0.225