Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414632.1 | internal | 169 | 3-509(+) |
Amino Acid sequence : | |||
GKTDDFETSLQVLRGFDTDISVEVNEIKRAVSSGSRSATIRFSDLKRRKYWFPLMVGIGLLVLQQLSGINGVLFYSSNIFKNAGISSSNVATFGLGLIQVIATAVTTWLADKSGRRLLLI VSSSGMTISLLIVAVAFYVEGIVSKDSHLYSVMGIFSLVGLVAMVIFFS | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,296.134 | ||
Theoretical pI: | 9.570 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 35.140 | ||
aromaticity | 0.101 | ||
GRAVY | 0.615 | ||
Secondary Structure Fraction | |||
Helix | 0.420 | ||
turn | 0.260 | ||
sheet | 0.225 |