Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414665.1 | 5prime_partial | 103 | 2-313(+) |
Amino Acid sequence : | |||
ELIEPNDLYLARRKLVELVLMSPRKTNLDPELVSFRRGRNDHKMSCSGEELTEIVCEDFRDGANIVREKKEYDELNSDMDHDVEFDYSDEDEDHDETMIAKDV* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 12,123.230 | ||
Theoretical pI: | 4.376 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 63.975 | ||
aromaticity | 0.058 | ||
GRAVY | -0.937 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.165 | ||
sheet | 0.311 |