Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414668.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
PDDGKILAMDVNRENYELGLPIIKKAGVAHKIDFREGPALPVLDQLLADEKNHGAYDFIFVDADKDNYLNYHKRLIELVKIGGVIGYDNTLWNGSVVAPPDAPMRKYIRYYRDFVIELNK ALAADPRIEICMLPVGDGITIRRRIQ* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,565.924 | ||
Theoretical pI: | 5.931 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
Instability index: | 40.884 | ||
aromaticity | 0.089 | ||
GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.199 | ||
sheet | 0.247 |