Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414671.1 | 5prime_partial | 110 | 1-333(+) |
Amino Acid sequence : | |||
NNVAQGFNKKMNSTVANLQKQLSGLKIVVFDIYTPLYDVVKSPSKYGFAEERRGCCGTGTVETTSFLCNPSSIGTCSNATQYVFWDSVHPSQAANQVLADALIVQGLSLI* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,867.339 | ||
Theoretical pI: | 7.841 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 33.295 | ||
aromaticity | 0.091 | ||
GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.282 | ||
sheet | 0.191 |