Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414674.1 | complete | 163 | 92-583(+) |
Amino Acid sequence : | |||
MAASTSTLFSVPGAISQTLQRHNSLLTNPSNISFQGLRSLPKNKLSSKIALPRRNSSGLVVKAELNPSLVISLSTGLSLFMGRFVFFNFQRENVAKQGLPEQNGITHFEAGDTRAKEYVS LLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKFFG* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,708.998 | ||
Theoretical pI: | 9.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 40.099 | ||
aromaticity | 0.098 | ||
GRAVY | 0.000 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.331 | ||
sheet | 0.227 |