Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414721.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
RGKRIVVAVDESKESMYALSWCLVHFFSQNTDNNTLILLYVKPPPPIYSSYDAAEYMFSKDAIKEIEKYRTDLVRKVMDRSEAVYTNFRTYDHINVERI | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,492.153 | ||
Theoretical pI: | 8.719 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 57.431 | ||
aromaticity | 0.131 | ||
GRAVY | 0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.242 | ||
sheet | 0.101 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414721.1 | internal | 99 | 299-3(-) |
Amino Acid sequence : | |||
DSLNINVVISSEVCIDSFGSIHHFTNQVSSIFLNFFNCIFGKHIFCSVVRGIDRRRWFDIEKNESVIVGVLRKKVNETPRKCIHALFTFIHCYHYSLPS | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,492.153 | ||
Theoretical pI: | 8.719 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 57.431 | ||
aromaticity | 0.131 | ||
GRAVY | 0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.242 | ||
sheet | 0.101 |