Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414726.1 | internal | 142 | 2-427(+) |
Amino Acid sequence : | |||
RELTSVVQKRFKFPENSVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIISGKLRAQRAKSMKFKDGYMISSGQPVNEYIDSAVRHVLLRQGVLGIKV KIMLDWDPEGKQGPTTRLPDLV | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,857.414 | ||
Theoretical pI: | 9.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 36.334 | ||
aromaticity | 0.070 | ||
GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.218 | ||
sheet | 0.268 |