Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414738.1 | complete | 159 | 25-504(+) |
Amino Acid sequence : | |||
MLHRIQNTKLMTRLTYTLDEIEGPFEVSQDKTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGEFLVPSYRGSSFLDPEGRGGSTGYDNAVALPAGGRGDEEELTKE NIKNAASSIGKITLSVTESKPETGEVIGVFESVQPSDTD* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,176.938 | ||
Theoretical pI: | 4.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 40.773 | ||
aromaticity | 0.075 | ||
GRAVY | -0.409 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.277 | ||
sheet | 0.245 |