Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414739.1 | internal | 133 | 401-3(-) |
Amino Acid sequence : | |||
LGIPSSILRADVLNVGTSTFKTILKSHFKLQDHCPILQGNWLIELLDYGIFPCLLTDKEAIVLMAITLGMFPHTLVIILLGDDPSPLKVLVERLVQQRVGGADLNEQRRDQEQQQRAPSH HPLCPDLLEPGEF | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,122.161 | ||
Theoretical pI: | 5.249 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 39.208 | ||
aromaticity | 0.090 | ||
GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.173 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414739.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
KLPRLEEIGTERMMGGRALLLLLVSALLVQIRASDPLLYEPFDEDFEGRWVVSKKDDYQGVWKHAKSDGHEDYGLLVSEKARKYAIIKELDEPVTLKDGTVVLQFEVRLQNGLECGGAYI KYIRPQDAGWDAK | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,122.161 | ||
Theoretical pI: | 5.249 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 39.208 | ||
aromaticity | 0.090 | ||
GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.173 | ||
sheet | 0.308 |