Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414756.1	5prime_partial	148	3-449(+)
Amino Acid sequence :
SSPPDSRRLEKSLSIARSRHDNMRSSDNTTENIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTEDFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGVFGMNFPISFFDVPHASRW VLIITGITGAFIFCSFVWFFKRRRLMPL*
Physicochemical properties
Number of amino acids:		148
Molecular weight:		17,032.421
Theoretical pI:		5.132
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		62.739
aromaticity		0.122
GRAVY		0.183
Secondary Structure Fraction
Helix		0.392
turn		0.209
sheet		0.243