Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414780.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
LSSLLALQLRIHQLAVRFWSLPFYMANRHTIILMQTSQNKATRTFMNYDSISQAMDGICGLYERKLRELNPAIRNLTYDIADLYNFIDGLADMSALVYDHSIQAFLPYDRQWIKQRTFQH LKKLAH* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,838.021 | ||
Theoretical pI: | 9.373 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 48.307 | ||
aromaticity | 0.119 | ||
GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.159 | ||
sheet | 0.286 |