Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414802.1	complete	133	48-449(+)
Amino Acid sequence :
MASSKFCGIILAIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCG*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,445.913
Theoretical pI:		8.688
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 625
Instability index:		55.968
aromaticity		0.030
GRAVY		0.610
Secondary Structure Fraction
Helix		0.293
turn		0.331
sheet		0.263