Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414808.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
KAKNLELHYLWNSVMASIPTHLNYTFKSFTSSNALSKSNTHFLGVRNYKLGWLRPSSIGPSNGCRAKCWFKFGKNGVDAEGAGIYGSQSRDDFDRDDVEQYYNYMGMLAVEGSYDKMEAL LNQNIHPVDILLLMAASEGDKPKIEELLRAGANFTVKDANGRTAVERA | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,749.928 | ||
Theoretical pI: | 7.925 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 37.285 | ||
aromaticity | 0.107 | ||
GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.274 | ||
sheet | 0.268 |