Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414818.1	complete	133	48-449(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS AWQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,629.096
Theoretical pI:		8.570
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 6125
Instability index:		53.232
aromaticity		0.038
GRAVY		0.579
Secondary Structure Fraction
Helix		0.308
turn		0.323
sheet		0.263