Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414828.1	internal	168	3-506(+)
Amino Acid sequence :
EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFKEGPALPLLDQLIADEKNHGTYDFIFVDADKDNYLNYHKRLIDLVKIGGVI GYDNTLWNGSVVAPPDAPMRKYVRYYRDFVIELNKALAADPRIEICML
Physicochemical properties
Number of amino acids:		168
Molecular weight:		18,889.636
Theoretical pI:		5.033
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20400 20400
Instability index:		25.395
aromaticity		0.095
GRAVY		-0.043
Secondary Structure Fraction
Helix		0.369
turn		0.196
sheet		0.298