Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY414828.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
EGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYELGLPVIEKAGVAHKIDFKEGPALPLLDQLIADEKNHGTYDFIFVDADKDNYLNYHKRLIDLVKIGGVI GYDNTLWNGSVVAPPDAPMRKYVRYYRDFVIELNKALAADPRIEICML | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,889.636 | ||
Theoretical pI: | 5.033 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
Instability index: | 25.395 | ||
aromaticity | 0.095 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.196 | ||
sheet | 0.298 |