Acc_NO	ORF type	length	start-end position (strand +/-)
>EY414850.1	internal	102	3-308(+)
Amino Acid sequence :
VFCCSYSHNVAPMGKFIAFVSTEAETDDPRTELRPGINLLEPVDAMFSDIYDRNEPVNEPALDNCFISTSYDATTHFESTVTDVLNMYTLITGKVLDLTVDL
Physicochemical properties
Number of amino acids:		102
Molecular weight:		11,373.617
Theoretical pI:		4.073
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6085
Instability index:		30.767
aromaticity		0.098
GRAVY		-0.022
Secondary Structure Fraction
Helix		0.324
turn		0.216
sheet		0.245