Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415132.1	complete	102	48-356(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTISSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTCYQG*
Physicochemical properties
Number of amino acids:		102
Molecular weight:		10,343.222
Theoretical pI:		8.362
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 2115
Instability index:		60.012
aromaticity		0.029
GRAVY		0.540
Secondary Structure Fraction
Helix		0.275
turn		0.324
sheet		0.245