Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415132.1 | complete | 102 | 48-356(+) |
Amino Acid sequence : | |||
MASSKFCGIILVIAILFHSTISSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTCYQG* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,343.222 | ||
Theoretical pI: | 8.362 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2115 | ||
Instability index: | 60.012 | ||
aromaticity | 0.029 | ||
GRAVY | 0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.324 | ||
sheet | 0.245 |