Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415222.1	complete	132	48-446(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTISSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLKFECACYSQLAYK CLPKVCSSRFPM*
Physicochemical properties
Number of amino acids:		132
Molecular weight:		13,657.283
Theoretical pI:		8.824
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3730
Instability index:		61.557
aromaticity		0.045
GRAVY		0.541
Secondary Structure Fraction
Helix		0.288
turn		0.295
sheet		0.265