Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415227.1 | internal | 180 | 2-541(+) |
Amino Acid sequence : | |||
FPYVKIVSAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVAIGPRFSNLISQTLLVLLKRLPPKGKKLLVFGTTSELGFLDSIGFCDAFSVTYHVPTLKTADAKKVLEQ LNVFAEEDIDAAAEALNDMTIKKLYMLIEMAAQGETGGSAEAIFSGKDKIKIDHFYDWLQ | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 19,995.032 | ||
Theoretical pI: | 5.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 34.192 | ||
aromaticity | 0.094 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.172 | ||
sheet | 0.306 |