Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415227.1	internal	180	2-541(+)
Amino Acid sequence :
FPYVKIVSAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVAIGPRFSNLISQTLLVLLKRLPPKGKKLLVFGTTSELGFLDSIGFCDAFSVTYHVPTLKTADAKKVLEQ LNVFAEEDIDAAAEALNDMTIKKLYMLIEMAAQGETGGSAEAIFSGKDKIKIDHFYDWLQ
Physicochemical properties
Number of amino acids:		180
Molecular weight:		19,995.032
Theoretical pI:		5.105
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14565
Instability index:		34.192
aromaticity		0.094
GRAVY		0.178
Secondary Structure Fraction
Helix		0.367
turn		0.172
sheet		0.306