Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415263.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
SAMKEENVELKCFWGSTLYHVDDVPFKLEDMPSNYGGFREKVKGLQVRKTIEALEQMKGLPTRGDVEPGDIPSMIDLGLNPSATISQDGKPGDNASLVGGETEALERLKKSAAECRAQPH KESNDGNHDSIYGANFSRKISPWMAIGCVSARTIFDELKKTARRTISASSNRNDG | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 19,159.300 | ||
Theoretical pI: | 5.961 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 39.804 | ||
aromaticity | 0.057 | ||
GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.286 | ||
sheet | 0.251 |