Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415272.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
AHIKGTNYDLPHVIKTAPTYPNVTHVGGNMFESIPKADAAIIKWVLHDWGDADCIQILKNCRKAIPENGKVIIVDAVLEPEGENLFDDTRLVYDVLMIAHVSGGKERTEAEWKSLLKEAG FPRYNIIKLPALVYIVEAHPN* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,725.939 | ||
Theoretical pI: | 5.840 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 14.375 | ||
aromaticity | 0.078 | ||
GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.206 | ||
sheet | 0.255 |