Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415381.1	internal	118	1-354(+)
Amino Acid sequence :
LLTRVSIGNERMTVKKMKSNRRASSVVCYAVPRNLQWVSTIASAVLMISKGTAIQKSFLVPLLAMQAPPSLIFWMKGEYGVWAAFLAFLVRLFFFIPGELELPFQALLLVLIAPYQVM
Physicochemical properties
Number of amino acids:		118
Molecular weight:		13,250.895
Theoretical pI:		10.287
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		30.526
aromaticity		0.119
GRAVY		0.697
Secondary Structure Fraction
Helix		0.424
turn		0.203
sheet		0.331