Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415382.1 | 3prime_partial | 114 | 1-342(+) |
Amino Acid sequence : | |||
MLNLDCDHYINNSKAFREAMCFLMDPNLGKHVCYVQFPQRFDGIDRSDRYANRNTVFFDINLRGLDGVQGPVYVGTGCVFNRTALYGYEPPLKPKHRKAGVLSSLCGGSRKKSS | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,869.599 | ||
Theoretical pI: | 9.224 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
Instability index: | 28.184 | ||
aromaticity | 0.114 | ||
GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.281 | ||
sheet | 0.175 |