Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415384.1 | 5prime_partial | 139 | 2-421(+) |
Amino Acid sequence : | |||
RARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELNGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNE WGYSQRVVDLAHIVASNWK* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,948.003 | ||
Theoretical pI: | 5.338 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 20.645 | ||
aromaticity | 0.058 | ||
GRAVY | 0.206 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.216 | ||
sheet | 0.266 |