Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415387.1	5prime_partial	122	1-369(+)
Amino Acid sequence :
FETLSYLPDLTQEQLGKEIDYLLRKGWVPCLEFDVHDGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSVQVLKEVEEAKKAYPDSFIRIIGFDNNRQVQCISFIAYKPPRFGNQFMIFY LS*
Physicochemical properties
Number of amino acids:		122
Molecular weight:		14,529.453
Theoretical pI:		5.660
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29910 30035
Instability index:		32.428
aromaticity		0.180
GRAVY		-0.381
Secondary Structure Fraction
Helix		0.377
turn		0.205
sheet		0.197