Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415388.1	internal	187	2-562(+)
Amino Acid sequence :
LIKKQGLEAAKKNNAENRKLIYNRAKQYSKEYEQQEKELVRLKREARLKGGFYVDPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLHRVEPYVTYGYPNLKS VRELVYKRGYGKLNKQRIPLTDNSIIEQGLGKYGIVCVEDLIHEIMTVGPHFKEANNFLWAFQLKAP
Physicochemical properties
Number of amino acids:		187
Molecular weight:		21,833.418
Theoretical pI:		9.973
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20400 20400
Instability index:		23.027
aromaticity		0.096
GRAVY		-0.476
Secondary Structure Fraction
Helix		0.353
turn		0.187
sheet		0.267