Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415391.1 | complete | 153 | 53-514(+) |
Amino Acid sequence : | |||
MACSGNMEVEFEIKSKADKFWECIKDSAAIFPKALSHDYKSIEVLEGSGMSAGSIRLIIYAEDSPLVKISKEKIDSFDDANKTYTYCVIDGDLTKYYKVFKGKLVVTPKPDGGSLVKWSS EFEKTSQDIPDPNLIKDFVVKNFVEIDDYLLHQ* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,250.496 | ||
Theoretical pI: | 4.971 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 31.512 | ||
aromaticity | 0.111 | ||
GRAVY | -0.284 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.216 | ||
sheet | 0.209 |