Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415405.1 | 5prime_partial | 104 | 1-315(+) |
Amino Acid sequence : | |||
SSVSETLDQLETMLSLESEKPEIFAFTSWGNFFNEIDFGWGSPFWSGVMGKDGPAFRNLVIFMDIEWGKGIEAWVTLEEKQMTLLETNPEFLAFASPNPAISSL* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,688.039 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27500 | ||
Instability index: | 41.124 | ||
aromaticity | 0.144 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.288 | ||
sheet | 0.308 |