Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415439.1 | 5prime_partial | 148 | 2-448(+) |
Amino Acid sequence : | |||
KTLKVTTXYCVYDSDISTGLGVGAFLFLMASQVLIMVASRCFCCGKALTPGGSRAWAVILFIICWLFFLIAEICLLAGSVRNAYQTKYAPFYKNLSCETLRKGVFGAGAAFILFTAIISE FYYVCYSRARESAQPYGRETGVGMGTYK* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,154.868 | ||
Theoretical pI: | 9.059 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26400 | ||
Instability index: | 34.621 | ||
aromaticity | 0.156 | ||
GRAVY | 0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.388 | ||
turn | 0.197 | ||
sheet | 0.259 |