Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415462.1 | 5prime_partial | 153 | 620-159(-) |
Amino Acid sequence : | |||
EAKNTGTSTCRCKTIFSVPACYSQTPTDLFAYFCLLVPFFLSRLPNFRSKGFFFFCCCCFDGKLAASSSISVEVTLFNLSKPSLLSTFESTSSSKDSGSVSLSEENSFCSILQLSHILYS PIKSSPFPLLSSSFDFTFIVSGLAEPKWSSLNT* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,292.116 | ||
Theoretical pI: | 4.959 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 53.893 | ||
aromaticity | 0.047 | ||
GRAVY | -1.269 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.213 | ||
sheet | 0.300 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415462.1 | complete | 150 | 76-528(+) |
Amino Acid sequence : | |||
MDMEEKPIMELPLDEHEELKLVNVQEENHVFKDDHLGSAKPETMNVKSKEEESKGKGDDLIGEYKMWESCKIEQKEFSSERETEPESFEEEVDSKVDSSEGFDKLNRVTSTEIDDDAASL PSKQQQQKKKKPLLRKFGSLLKKKGTSKQK* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 17,292.116 | ||
Theoretical pI: | 4.959 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 53.893 | ||
aromaticity | 0.047 | ||
GRAVY | -1.269 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.213 | ||
sheet | 0.300 |